✅ 7 criteria passed
❌ 4 criteria to solve
Boost cookcountytreasurer.com's SEO with Kontactr's Guest Posting.
Secure high-authority, do-follow backlinks from our trusted site—DA44 domain authority and PA55 homepage and blog pages.
Perfect for webmasters seeking higher search rankings and increased organic traffic.
Simple, quick, and effective.
opens a new window
Cook County Treasurer's Office - Chicago, Illinois
https://cookcountytreasurer.com
https://cookcountytreasurer.com
Cook County Treasurer's Office - Chicago, Illinois
No 301 redirects are in place to redirect traffic to your preferred domain. Pages that load successfully both with and without www. are treated as duplicate content! Not all versions of your page point to the same URL.
| Attribute | Value |
| ⓘ viewport | width=device-width, initial-scale=1.0 |
ⓘ The results of our semantic analysis are shown below using the website's language.
They are the main concepts covered by cookcountytreasurer.com.
Each concept has a confidence score. The higher it is, the more important the topic is relative to the page.
| Topics | |
Cook County, Illinois Confidence: 78%
|
|
Treasurer Confidence: 72%
|
✅ cookcountytreasurer.com website speed is normal. Page speed is important for visitors and search engines.
Get insights to improve your page loading time.
This domain loads at the median speed of 0.8 seconds.
cookcountytreasurer.com is faster than approximately 88 percent of the web. Your website page speed needs to be as fast as you can make it, without compromising the customer experience.
A good goal to achieve is a loading time of 2 seconds on desktop and mobile devices.
ⓘ This website is ranked #220.214 by Alexa.
This rank is traffic based. The lower the rank is, the better the domain is ranked.
| Country | Rank |
United States of America |
#54.936 |
Mobile Rendering
This website seems to be optimized for Mobile Visitors.
Phone
Tablet
A good text to HTML ratio is anywhere from 25 to 70%.
This percentage refers to the visible text ratio, as opposed to HTML elements, image tags and other non-visible information.
Great, we found headings on this page.
| Top level heading |
| Original text |
We found 41 images on this website.
20
ALT attributes are missing on your image tags. The issue affects 2 actual different images that could be loaded more than once in your page.
| Image | Image URL | Occurrences |
![]() |
Images/UpArrow.png | 10 |
![]() |
Images/DownArrow.png | 10 |
Alternative text allows you to add a description to an image.
Google rely on alternative text attributes to determine relevance to a search query. Alternative text also makes an image more likely to appear in a Google image search.
It looks like you're missing alternative text for 20 images on cookcountytreasurer.com. Check your website to make sure it's specified for each image on the page.
For a better readability, only the first 50 internal links are shown below.
| Anchor | Type | URL |
![]() |
image | default.aspx |
| Check Your Payment Status or Make an Online Payment | text | yourpropertytaxoverviewsearch.aspx |
| Pay By Mail or In Person | text | makingpaymentsbymailorinperson.aspx |
| Pay At Chase Bank | text | makingpaymentsatchasebank.aspx |
| Pay At Your Local Community Bank | text | communitybank.aspx |
| Get a Copy of Your Tax Bill | text | requestaduplicatetaxbillsearch.aspx |
| Returned Checks | text | returnedchecks.aspx |
| Information about Prior Year Property Taxes | text | prioryears.aspx |
| Paying First Installment Property Taxes Early | text | prepayment.aspx |
| If Taxes Were Sold | text | iftaxesweresold.aspx |
| Multiple Payments Via Wire Transfer | text | makingmultiplepaymentsviawiretransfer.aspx |
| Exemption History Search | text | exemptionhistorysearch.aspx |
| Lists of Properties Missing Senior Exemptions | text | seniorexemptionspropertylist.aspx |
| Homeowner Exemption | text | homeownerexemption.aspx |
| Senior Citizen Homestead Exemption | text | seniorcitizenhomesteadexemption.aspx |
| Senior Citizen Assessment Freeze Exemption | text | seniorcitizenassessmentfreezeexemption.aspx |
| Home Improvement Exemption | text | homeimprovement.aspx |
| Property Tax Relief for Military Personnel | text | currentmilitarywaiverform.aspx |
| Disabled Veteran Homestead Exemption | text | disabledveteranhomesteadexemption.aspx |
| Overpayment Refund Search | text | duplicateandoverpaymentrefundsearch.aspx |
| Overpayment Refund Status Search | text | duplicateandoverpaymentrefundstatussearch.aspx |
| How to Apply for a Property Tax Refund | text | howtoapplyforarefund.aspx |
| Uncashed Check Search | text | uncashedchecksearch.aspx |
| Property Tax Appeal Board Refunds | text | ptabrefundsearch.aspx |
| Estate Search | text | estatesearch.aspx |
| Exemptions | text | exemptions.aspx |
| The Senior Citizen Real Estate Tax Deferral Program | text | theseniorcitizenrealestatetaxdeferralprogram.aspx |
| Third-Party Notification | text | thirdpartynotification.aspx |
| Understanding Your Bill | text | understandingyourtaxbill.aspx |
| About Your Property Index Number (PIN) | text | aboutyourpin.aspx |
| Update Your Name or Mailing Address | text | nameoraddresschangesearch.aspx |
| Monitoring Your Mortgage | text | monitoringyourmortgage.aspx |
| Taxing Districts' Financial Statements and Disclosures | text | taxingdistrictssearch.aspx |
| Sign In to Your Electronic Billing Account | text | accountsignin.aspx |
| Avoid the Tax Year 2018 Annual Tax Sale | text | delinquentpropertytaxsearch.aspx |
| Search Tax Year 2015-2017 Annual Tax Sale Results | text | annualtaxsaleresults.aspx |
| Foreign Language Brochures | text | pamphlets.aspx?language=english |
| Duplicate or Overpayment Refund | text | duplicateoroverpaymentrefundform.aspx |
| Property Tax Appeal Board Refunds | text | propertytaxappealboardrefundform.aspx |
| Certificate of Error Refund | text | certificateoferrorrefundform.aspx |
| Third Party Notification Request | text | thirdpartynotificationform.aspx |
| Freedom of Information Act (FOIA) Request | text | freedomofinformationrequestform.aspx |
| Duties and Responsibilities of the Cook County Treasurer | text | dutiesandresponsibilities.aspx |
| Maria Pappas, Cook County Treasurer's Biography | text | treasurersbiography.aspx |
| Maria Pappas, Cook County Treasurer's Resume | text | treasurersresume.aspx |
| Freedom of Information Requests | text | freedomofinformationact.aspx |
| State of the Office | text | stateoftheoffice.aspx |
| Search the News and Video Library | text | newsandvideos.aspx |
| Important Dates | text | duedates.aspx |
| Disclaimer of Liability | text | disclaimer.aspx |
| Anchor | Type | URL |
| Single or Multiple Payments Via ACH | text | http://www.cookcountytpa.com/ |
![]() |
image | https://www.facebook.com/cookcountytreasurer |
![]() |
image | https://www.youtube.com/channel/ucp8om8jeuhl_j99qrepehvg |
| Cook County Government | text | http://www.cookcountyil.gov/ |
| County Assessor | text | http://www.cookcountyassessor.com/ |
| Board of Review | text | http://www.cookcountyboardofreview.com/ |
| County Clerk | text | http://www.cookcountyclerk.com/ |
| Recorder of Deeds | text | http://www.cookrecorder.com/ |
| Cook County Property Tax Portal | text | http://www.cookcountypropertyinfo.com/ |
| Browse Aloud | text | https://www.texthelp.com/en-us |
| Google™ Translate | text | https://translate.google.com/ |
![]() |
image | https://translate.google.com |
| Illinois Information Technology Accessibility Act | text | http://www.dhs.state.il.us/iitaa |
| Americans with Disabilities Act | text | http://www.ada.gov/ |
| ⓘ Domain Registrar | NETWORK SOLUTIONS, LLC |
| ⓘ Registration Date | 02/14/2000 25 years, 11 months, 23 days ago |
| ⓘ Last Modified | 10/22/2019 6 years, 3 months, 13 days ago |
| ⓘ Expiration Date | 02/14/2024 Expired |
| Host | IP Address | Country |
| ns1.servercentral.net | 64.202.97.7 | United States |
| ns2.servercentral.net | 64.202.97.8 | United States |
| ns3.servercentral.net | 64.202.97.9 | United States |
| Domain |
United States of America (96.9%)
ⓘ Responsive website, mobile-friendly.
SOCIAL MEDIA PRESENCE
You have a relatively high presence on social media, keep going!
The more people share your website, the more likely you will get links from others, which is a key point when it comes to improving your overall search engine rankings.