mobile
Mobile menu

SEO Report for fluege.de

Dec 10, 2019 4:48 pm
Don't have a calculation code?
Desktop screen Desktop screenshot for fluege.de
62

7 criteria passed
4 criteria to solve

PERFORMANCE OPPORTUNITIES

Make your meta description eloquent and appealing, neither too short nor too long.
Arrow
Make all versions of your website point to the same URL.
Arrow

OVERVIEW

• Category
Travel  >  Air Travel
• Alexa Rank
#25.221, fluege.de is in the world's top 50.000 websites!

FREE FORM BUILDER

Representation of an online Form

Free online forms for your website

Use our free online form builder to create any type of form for fluege.de.

Beauty and simplicity.

Use templates. No coding. Embed anywhere. Get emails. Collect data.


opens a new window

SEO

SSL Certificate
This website is not SSL secured (HTTPS), the certificate issued by Let's Encrypt has expired on March 5, 2020.
Title Tag
Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de
Length: 72 (recommended: 10 to 70)
Meta Description
Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de, Reisen buchen bei fluege.de - Ihre Adresse für Urlaub und Reise (Lastminute, Pauschalreisen, Flüge, Hotels, Mietwagen)
Length: 194 (recommended: 50 to 160)
Google preview
Desktop Version

Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de

https://fluege.de

Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de, Reisen buchen bei fluege.de - Ihre Adresse für Urlaub und Reise (Lastminute, Pauschalreisen, Fl...

Mobile Version

Favicon for fluege.de https://fluege.de

Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de

Günstige Flüge online buchen – Flug-Angebote vergleichen | fluege.de, Reisen buchen bei fluege.de - Ihre Adresse für Urlaub und Re...

Encoding
Great, language/character encoding is specified: utf-8
URL Resolve

No 301 redirects are in place to redirect traffic to your preferred domain. Pages that load successfully both with and without www. are treated as duplicate content! Not all versions of your page point to the same URL.

Robots.txt
No robots.txt file was found on this page.
URL Parameters
Great, the domain URLs look clean.
Attribute Value
copyright copyright(c) 2019 fluege.de, fluege.de
language de_DE
author fluege.de
expires 0
revisit-after 3 days
viewport width=1220
robots index,follow

SEMANTIC ANALYSIS

The owner has associated the following topics to the website.

The results of our semantic analysis are shown below using the website's language.

They are the main concepts covered by fluege.de.

Each concept has a confidence score. The higher it is, the more important the topic is relative to the page.

Topics
Unister Confidence: 88% Arrow up

Die Unister Holding GmbH, kurz Unister, ist ein deutsches Unternehmen mit Hauptsitz in Leipzig, das Webportale betreibt und vermarktet.

Seit dem 18.

Juli 2016 befindet sich das Unternehmen im vorläufigen Insolvenzverfahren.

Pauschalreise Confidence: 72% Arrow up

Pauschalreise ist eine Reise, bei der ein Reiseveranstalter einem Reisenden mindestens zwei Reiseleistungen, von denen keine von lediglich geringer Bedeutung ist, im eigenen Namen zu einem einheitlichen Reisepreis zu erbringen verspricht.

Reise Confidence: 71% Arrow up

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen (Rundreise).

Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort.

Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette (wie beispielsweise Bus – Flugzeug – Straßenbahn – Taxi).

Last minute Confidence: 70% Arrow up

Der Begriff last minute ist ein Begriff der Tourismusbranche und bezeichnet Reisen, die nicht langfristig im Voraus gebucht werden.

Urlaub Confidence: 69% Arrow up

Urlaub ist bei einem Arbeitsverhältnis der Zeitraum, in dem ein arbeitsfähiger Arbeitnehmer, Beamter, Soldat oder auch Selbständiger unter Fortzahlung des Arbeitsentgelts von der Arbeitspflicht zur Erbringung von Arbeitsleistungen befreit ist.

WEBSITE SPEED

fluege.de website speed is normal. Page speed is important for visitors and search engines.

Get insights to improve your page loading time.

Page Loading Time

1.8s

This domain loads at the median speed of 1.8 seconds.

Speed Percentile

49%

fluege.de is faster than approximately 49 percent of the web. Your website page speed needs to be as fast as you can make it, without compromising the customer experience.

A good goal to achieve is a loading time of 2 seconds on desktop and mobile devices.

TRAFFIC

This website is ranked #25.221 by Alexa.

This rank is traffic based. The lower the rank is, the better the domain is ranked.

Daily visitors by country

  • fluege.de daily visitors distribution - Total: 3 countries
  • Flag for GermanyGermany (82.2%)
  • Flag for SwitzerlandSwitzerland (9.1%)
  • Flaf icon for other countryOthers (8.7%)

Traffic country ranks

Country Rank
Flag for GermanyGermany #974
Flag for SwitzerlandSwitzerland #1.696
Flag for PakistanPakistan #52.823

LAYOUT

Doctype HTML5 Arrow Responsive website, mobile-friendly. Arrow

Mobile Rendering

This website seems to be optimized for Mobile Visitors.

Phone
How fluege.de looks like on a mobile device such as an iPhone.

Tablet
How fluege.de looks like on a tablet such as an iPad.

Main colors used

These are the main HTML color codes used by this website. Arrow
  • 18% #4070b0
  • 14% #f0f0f0
  • 13% #2070d0
  • 12% #ffffff
  • 4% #e0e0e0
  • 4% #202020
  • 3% #a0c0e0
  • 2% #4080d0
  • 2% #e0c0a0
  • 2% #c0b090
  • 2% #6090d0
  • 1% #a07030

Text/code ratio

fluege.de's text/code ratio is 9.02%. It's a bit low. Consider raising it by adding more text content of value for your visitors, or keeping your code clean.
Text / Code Ratio 9.02%

A good text to HTML ratio is anywhere from 25 to 70%.

This percentage refers to the visible text ratio, as opposed to HTML elements, image tags and other non-visible information.

Main HTML tags

Headings Arrow up

Great, we found headings on this page.

  • <H1> 1
  • <H2> 2
  • <H3> 3
  • <H4> 0
  • <H5> 0
  • <H6> 0
<H1>
Top level heading
Flüge vergleichen und günstige angebote finden
<H2>
2nd level heading
Wir benötigen ıhre zustimmung
Günstige flüge von renommierten airlines
<H3>
3rd level heading
Mein fluege.de kundenkonto
Mit billigairlines richtig günstig fliegen
Flüge buchen leicht gemacht – auf beliebten routen und von passenden flughäfen
Alt attributes Arrow up

We found 40 images on this website.
22 ALT attributes are missing on your image tags. The issue affects 19 actual different images that could be loaded more than once in your page.

Alternative text allows you to add a description to an image.

Google rely on alternative text attributes to determine relevance to a search query. Alternative text also makes an image more likely to appear in a Google image search.

It looks like you're missing alternative text for 22 images on fluege.de. Check your website to make sure it's specified for each image on the page.

SOCIAL

This is an overview of your homepage shares on social networks.

You have a relatively high presence on social media, keep going!

The more people share your website, the more likely you will get links from others, which is a key point when it comes to improving your overall search engine rankings.

  • Facebook iconFacebook
  • Total Engagement 3.308
  • Likes 90
  • Shares 2.810
  • Comments 408

SERVER

Server map
  • Service Provider (ISP)
  • Keyweb AG IP Network
  • IP Address
  • 87.118.69.230
  • Country
  • Flag for GermanyGermany
  • Region
  • Saxony , Leipzig
  • Latitude and Longitude
  • 51.341 : 12.3728

SHARE