Mobile menu

SEO Report for

November 16, 2019 5:36 PM
Desktop screen Desktop screenshot for


Favicon for

9 criteria passed
2 criteria to solve


Make your title tag clear, concise and include your most important keywords.
Fill the missing alt attributes on your images.


• Category
Travel  >  Air Travel  >  Hotels
• Alexa Rank
#39.484, is in the world's top 50.000 websites!


Representation of an online Form

Free online forms for your website

Use our free online form builder to create any type of form for

Beauty and simplicity.

Use templates. No coding. Embed anywhere. Get emails. Collect data.

opens a new window


SSL Certificate
This website is not SSL secured (HTTPS), the certificate issued by Let's Encrypt has expired on January 9, 2020.
Title Tag – Last Minute Urlaub online buchen, Reisen, Hotels, Flüge + Hotel, Städtereisen, Urlaubsreisen-Buchung
Length: 120 (recommended: 10 to 70)
Meta Description
Beim mehrfach ausgezeichneten Last Minute Reise Spezialist buchen & auf ► Top Reiseschnäppchen mit Preisgarantie sichern! ☀
Length: 146 (recommended: 50 to 160)
Google preview
Desktop Version – Last Minute Urlaub online buchen, Reisen, Hotels, Flüg...

Beim mehrfach ausgezeichneten Last Minute Reise Spezialist buchen & auf ► Top Reiseschnäppchen mit Preisgarantie sichern! ☀

Mobile Version

Favicon for – Last Minute Urlaub online buchen, Reisen, Hotels, Flüg...

Beim mehrfach ausgezeichneten Last Minute Reise Spezialist buchen & auf ► Top Reiseschnäppchen mit Preisgarantie...

Great, language/character encoding is specified: utf-8
URL Resolve

Great, a redirect is in place to redirect traffic from your non-preferred domain. All versions of your page point to the same URL.

URL Parameters
Great, the domain URLs look clean.
Attribute Value
viewport width=device-width, minimum-scale=1, initial-scale=1, user-scalable=yes
robots index, follow


The results of our semantic analysis are shown below using the website's language.

They are the main concepts covered by

Each concept has a confidence score. The higher it is, the more important the topic is relative to the page.

Reise Confidence: 71% Arrow up

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen (Rundreise).

Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort.

Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette (wie beispielsweise Bus – Flugzeug – Straßenbahn – Taxi).

Urlaub Confidence: 70% Arrow up

Urlaub ist bei einem Arbeitsverhältnis der Zeitraum, in dem ein arbeitsfähiger Arbeitnehmer, Beamter, Soldat oder auch Selbständiger unter Fortzahlung des Arbeitsentgelts von der Arbeitspflicht zur Erbringung von Arbeitsleistungen befreit ist.

Hotel Confidence: 69% Arrow up

Ein Hotel ist ein Beherbergungs- und Verpflegungsbetrieb für Gäste gegen Bezahlung.

Es ist ein touristisches, dem Hotel- und Gaststättengewerbe zuzuordnendes Unternehmen.

Für die Branche gilt der Begriff Hotelgewerbe.

Last minute Confidence: 67% Arrow
Reisevertrag Confidence: 66% Arrow

WEBSITE SPEED website speed is normal. Page speed is important for visitors and search engines.

Get insights to improve your page loading time.

Page Loading Time


This domain loads at the median speed of 2.3 seconds.

Speed Percentile

35% is faster than approximately 35 percent of the web. Your website page speed needs to be as fast as you can make it, without compromising the customer experience.

A good goal to achieve is a loading time of 2 seconds on desktop and mobile devices.


This website is ranked #39.484 by Alexa.

This rank is traffic based. The lower the rank is, the better the domain is ranked.

Daily visitors by country

  • daily visitors distribution - Total: 3 countries
  • Flag for GermanyGermany (82.4%)
  • Flag for SwitzerlandSwitzerland (6.4%)
  • Flaf icon for other countryOthers (11.2%)

Traffic country ranks

Country Rank
Flag for GermanyGermany #1.450
Flag for SwitzerlandSwitzerland #3.611
Flag for TurkeyTurkey #77.821


Doctype HTML5 Arrow Responsive website, mobile-friendly. Arrow

Mobile Rendering

This website seems to be optimized for Mobile Visitors.

How looks like on a mobile device such as an iPhone.

How looks like on a tablet such as an iPad.

Main colors used

These are the main HTML color codes used by this website. Arrow
  • 40% #a0a0a0
  • 18% #f0f0f0
  • 12% #ffffff
  • 9% #403030
  • 5% #a02070
  • 3% #a09090
  • 3% #a09080
  • 3% #903060
  • 1% #906080
  • 1% #603050
  • 0% #a05080
  • 0% #609090

Text/code ratio's text/code ratio is 3.27%. It's a bit low. Consider raising it by adding more text content of value for your visitors, or keeping your code clean.
Text / Code Ratio 3.27%

A good text to HTML ratio is anywhere from 25 to 70%.

This percentage refers to the visible text ratio, as opposed to HTML elements, image tags and other non-visible information.

Main HTML tags

Headings Arrow up

Great, we found headings on this page.

  • <H1> 1
  • <H2> 1
  • <H3> 4
  • <H4> 7
  • <H5> 9
  • <H6> 3
Top level heading
Last minute urlaub, reisen & ıdeen
2nd level heading
Wohin im last minute urlaub?
3rd level heading
Aktuelle reiseangebote
Die besten angebote für strandurlaub oder städtereise
Testurteil “sehr gut”:
4th level heading
Last minute urlaub
Städtereisen im herbst
Silvester 2019
Jetzt heißt es schnell sein
5th level heading
Aktuelle hinweise zu condor und thomas cook
Last minute urlaub
6th level heading
Die welt mit nur einem klick
Buchen so einfach wie nie
Wir sind pink
Alt attributes Arrow up

We found 22 images on this website.
22 ALT attributes are missing on your image tags. The issue affects 16 actual different images that could be loaded more than once in your page.

Image Image URL Occurrences
Image with missing alt attribute found on,h_80,w_372/f_auto/q_auto:best... 1
Image with missing alt attribute found on 2
Image with missing alt attribute found on 2
Image with missing alt attribute found on 1
Image with missing alt attribute found on 1

Alternative text allows you to add a description to an image.

Google rely on alternative text attributes to determine relevance to a search query. Alternative text also makes an image more likely to appear in a Google image search.

It looks like you're missing alternative text for 22 images on Check your website to make sure it's specified for each image on the page.


This is an overview of your homepage shares on social networks.

You're doing quiet good on social media!

Social shares are a key signal, among many others, that search engines use to evaluate the rankings of a website. Asking people to share your pages, adding visible social share buttons and make great quality content are 3 of the most powerful ways to grow your social presence.

  • Facebook iconFacebook
  • Total Engagement 962
  • Likes 78
  • Shares 759
  • Comments 125
  • Pinterest iconPinterest 0
  • Linkedin iconLinkedin 0
  • Stumbleupon iconStumbleupon 0


Server map
  • Service Provider (ISP)
  • Amazon Technologies Inc.
  • IP Address
  • Country
  • Flag for IrelandIreland
  • Region
  • Leinster , Dublin
  • Latitude and Longitude
  • 53.3498 : -6.26031