Mobile menu

SEO Report for

November 6, 2019 7:21 AM
Desktop screen Desktop screenshot for


Favicon for

7 criteria passed
4 criteria to solve


Make your title tag clear, concise and include your most important keywords.
Make your meta description eloquent and appealing, neither too short nor too long.


• Category
• Online since
• Age
19 years, 4 months, 6 days
• Alexa Rank
#71.111, is in the world's top 100.000 websites!


Representation of an online Form

Free online forms for your website

Use our free online form builder to create any type of form for

Beauty and simplicity.

Use templates. No coding. Embed anywhere. Get emails. Collect data.

opens a new window


SSL Certificate
This website is not SSL secured (HTTPS), the certificate issued by COMODO CA Limited has expired on August 28, 2020.
Title Tag
sonnenklar.TV – Günstig Urlaub & Reisen buchen - Billige Urlaubsreisen - günstig verreisen - billig Reisen - günstig in den Urlaub
Length: 139 (recommended: 10 to 70)
Meta Description
Jetzt günstig Reisen, Badeurlaub, Hotels, Lastminute Angebote, Städtereisen, Kreuzfahrten und Pauschalreisen buchen. Hier finden Sie Reisevideos & preiswerte Angebote der Woche!
Length: 183 (recommended: 50 to 160)
Google preview
Desktop Version

sonnenklar.TV – Günstig Urlaub & Reisen buchen - Billige Urlaubsre...

Jetzt günstig Reisen, Badeurlaub, Hotels, Lastminute Angebote, Städtereisen, Kreuzfahrten und Pauschalreisen buchen. Hier finden Sie Reisevideos & preiswerte Ang...

Mobile Version

Favicon for

sonnenklar.TV – Günstig Urlaub & Reisen buchen - Billige Urlaubsre...

Jetzt günstig Reisen, Badeurlaub, Hotels, Lastminute Angebote, Städtereisen, Kreuzfahrten und Pauschalreisen buchen. Hier finden S...

Great, language/character encoding is specified: utf-8
URL Resolve

Great, a redirect is in place to redirect traffic from your non-preferred domain. All versions of your page point to the same URL.

URL Parameters
Great, the domain URLs look clean.
Attribute Value
viewport width=device-width, initial-scale=1, maximum-scale=1
copyright 2019
robots index,follow


The results of our semantic analysis are shown below using the website's language.

They are the main concepts covered by

Each concept has a confidence score. The higher it is, the more important the topic is relative to the page.

Sonnenklar.TV Confidence: 86% Arrow up

sonnenklar.TV ist ein deutscher Privatsender mit Sitz in München (seit Juni 2010, vorher Ludwigsburg).

Das Programm besteht zum Großteil (von 9 bis 23 Uhr) aus Verkaufssendungen für Urlaubsreisen.

Produziert wird sonnenklar.TV von der Euvía Travel GmbH.

Im Geschäftsjahr 2013/14 erzielte sonnenklar einen Umsatz von 229,6 Millionen Euro.

Pauschalreise Confidence: 72% Arrow up

Pauschalreise ist eine Reise, bei der ein Reiseveranstalter einem Reisenden mindestens zwei Reiseleistungen, von denen keine von lediglich geringer Bedeutung ist, im eigenen Namen zu einem einheitlichen Reisepreis zu erbringen verspricht.

Urlaub Confidence: 71% Arrow up

Urlaub ist bei einem Arbeitsverhältnis der Zeitraum, in dem ein arbeitsfähiger Arbeitnehmer, Beamter, Soldat oder auch Selbständiger unter Fortzahlung des Arbeitsentgelts von der Arbeitspflicht zur Erbringung von Arbeitsleistungen befreit ist.

Last minute Confidence: 70% Arrow up

Der Begriff last minute ist ein Begriff der Tourismusbranche und bezeichnet Reisen, die nicht langfristig im Voraus gebucht werden.

Reise Confidence: 69% Arrow up

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen (Rundreise).

Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort.

Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette (wie beispielsweise Bus – Flugzeug – Straßenbahn – Taxi).

WEBSITE SPEED website speed is slow. Page speed is important for visitors and search engines.

Get insights to improve your page loading time.

Page Loading Time


This domain loads at the median speed of 3.9 seconds.

Speed Percentile

15% is faster than approximately 15 percent of the web. Your website page speed needs to be as fast as you can make it, without compromising the customer experience.

A good goal to achieve is a loading time of 2 seconds on desktop and mobile devices.


This website is ranked #71.111 by Alexa.

This rank is traffic based. The lower the rank is, the better the domain is ranked.

Alexa data for

Daily visitors by country

  • daily visitors distribution - Total: 2 countries
  • Flag for GermanyGermany (91.4%)
  • Flag for EgyptEgypt (4.8%)
  • Flaf icon for other countryOthers (3.8%)

Traffic country ranks

Country Rank
Flag for GermanyGermany #4.543
Flag for EgyptEgypt #21.808


Doctype HTML5 Arrow Responsive website, mobile-friendly. Arrow

Mobile Rendering

This website seems to be optimized for Mobile Visitors.

How looks like on a mobile device such as an iPhone.

How looks like on a tablet such as an iPad.

Main colors used

These are the main HTML color codes used by this website. Arrow
  • 34% #f0f0f0
  • 11% #ffffff
  • 9% #104060
  • 4% #80a0b0
  • 4% #205070
  • 3% #406070
  • 3% #b0d0d0
  • 3% #b0d0f0
  • 3% #608090
  • 2% #f0ffff
  • 2% #e0e0f0
  • 2% #e05010

Text/code ratio's text/code ratio is 13.75%. It's a bit low. Consider raising it by adding more text content of value for your visitors, or keeping your code clean.
Text / Code Ratio 13.75%

A good text to HTML ratio is anywhere from 25 to 70%.

This percentage refers to the visible text ratio, as opposed to HTML elements, image tags and other non-visible information.

Main HTML tags

Headings Arrow up

Great, we found headings on this page.

  • <H1> 1
  • <H2> 3
  • <H3> 5
  • <H4> 0
  • <H5> 0
  • <H6> 0
Top level heading
Günstig urlaub & reisen buchen
2nd level heading
Günstige urlaubsreisen: reisen mit
Wohin soll es gehen?
Die beliebtesten strand-ziele
3rd level heading - reiselust
Mit in die ferne
Unterwegs zum kleinen preis
Günstig verreisen & städte erleben
Bewertung für - euvia travel gmbh
Alt attributes Arrow up

We found 18 images on this website.
6 ALT attributes are missing on your image tags. The issue affects 5 actual different images that could be loaded more than once in your page.

Alternative text allows you to add a description to an image.

Google rely on alternative text attributes to determine relevance to a search query. Alternative text also makes an image more likely to appear in a Google image search.

It looks like you're missing alternative text for 6 images on Check your website to make sure it's specified for each image on the page.


This is an overview of your homepage shares on social networks.

You have a relatively high presence on social media, keep going!

The more people share your website, the more likely you will get links from others, which is a key point when it comes to improving your overall search engine rankings.

  • Facebook iconFacebook
  • Total Engagement 6.906
  • Likes 723
  • Shares 5.799
  • Comments 384
  • Pinterest iconPinterest 0
  • Linkedin iconLinkedin 0
  • Stumbleupon iconStumbleupon 0


Domain Registrar KEY-SYSTEMS GMBH
Registration Date 05/23/2001 19 years, 4 months, 6 days ago
Last Modified 05/24/2019 1 year, 4 months, 6 days ago
Expiration Date 05/23/2020 Expired
Nameservers Arrow up
Host IP Address Country Flag for GermanyGermany Flag for GermanyGermany Flag for GermanyGermany


Server map
  • Service Provider (ISP)
  • GmbH
  • IP Address
  • Country
  • Flag for GermanyGermany
  • Region
  • Baden-Württemberg , Karlsruhe
  • Latitude and Longitude
  • 49.0102 : 8.38362


The owner has chosen to keep his whois contact information private.
Add a beautiful, spam free contact form to your website in minutes.