mobile
Mobile menu

SEO Report for meiers-weltreisen.de

December 25, 2019 9:45 PM
Desktop screen Desktop screenshot for meiers-weltreisen.de
72

8 criteria passed
3 criteria to solve

PERFORMANCE OPPORTUNITIES

Make your meta description eloquent and appealing, neither too short nor too long.
Arrow
Fill the missing alt attributes on your images.
Arrow

OVERVIEW

• Category
Travel
• Alexa Rank
#305.453, meiers-weltreisen.de is in the world's top 1 million websites

FREE FORM BUILDER

Representation of an online Form

Free online forms for your website

Use our free online form builder to create any type of form for meiers-weltreisen.de.

Beauty and simplicity.

Use templates. No coding. Embed anywhere. Get emails. Collect data.


opens a new window

SEO

SSL Certificate
Great, this website is SSL secured (HTTPS).
The certificate issued by DigiCert Inc is valid from August 28, 2018 to October 10, 2020.
Title Tag
Traumurlaub beim Fernreisen-Spezialisten buchen | MEIERS WELTREISEN
Length: 67 (recommended: 10 to 70)
Meta Description
Entdecken Sie mit MEIERS WELTREISEN die schönsten Traumziele der Welt & buchen Sie Hotel, Flug, Rundreise, Mietwagen oder Camper online bei Ihrem Fernreisen-Spezialisten.
Length: 175 (recommended: 50 to 160)
Google preview
Desktop Version

Traumurlaub beim Fernreisen-Spezialisten buchen | MEIERS WELTREISEN

https://meiers-weltreisen.de

Entdecken Sie mit MEIERS WELTREISEN die schönsten Traumziele der Welt & buchen Sie Hotel, Flug, Rundreise, Mietwagen oder Camper online bei Ihrem Fernreisen-Spez...

Mobile Version

Favicon for meiers-weltreisen.de https://meiers-weltreisen.de

Traumurlaub beim Fernreisen-Spezialisten buchen | MEIERS WELTREISEN

Entdecken Sie mit MEIERS WELTREISEN die schönsten Traumziele der Welt & buchen Sie Hotel, Flug, Rundreise, Mietwagen oder Camp...

Encoding
Great, language/character encoding is specified: utf-8
URL Resolve
URL Parameters
Great, the domain URLs look clean.
Attribute Value
robots index, follow
viewport width=device-width, initial-scale=1, maximum-scale=1.0, user-scalable=no

SEMANTIC ANALYSIS

The results of our semantic analysis are shown below using the website's language.

They are the main concepts covered by meiers-weltreisen.de.

Each concept has a confidence score. The higher it is, the more important the topic is relative to the page.

Topics
Camping Confidence: 77% Arrow up

Camping (auch Kampieren, von lat. campus „Feld“) bezeichnet eine Form des Tourismus.

Die Urlauber übernachten in diesem Fall in Zelten, Wohnwagen oder Wohnmobilen.

Wird in Zelten gecampt, so spricht man auch von Zelten.

Buchen Confidence: 73% Arrow up

Die Buchen (Fagus) sind die einzige Pflanzengattung der Unterfamilie der Fagoideae innerhalb der Familie der Buchengewächse (Fagaceae).

Die etwa elf Arten besitzen eine weite Verbreitung in den gemäßigten Gebieten der Nordhalbkugel in Nordamerika und Eurasien.

Hotel Confidence: 70% Arrow up

Ein Hotel ist ein Beherbergungs- und Verpflegungsbetrieb für Gäste gegen Bezahlung.

Es ist ein touristisches, dem Hotel- und Gaststättengewerbe zuzuordnendes Unternehmen.

Für die Branche gilt der Begriff Hotelgewerbe.

Reise Confidence: 69% Arrow up

Der Begriff Reise bedeutet im Sinne der Verkehrswirtschaft die Fortbewegung von Personen über eine längere Zeit zu Fuß oder mit Verkehrsmitteln außerhalb des Wirtschaftsverkehrs, um ein einzelnes Ziel zu erreichen oder mehrere Orte kennenzulernen (Rundreise).

Im fremdenverkehrswirtschaftlichen Sinne umfasst eine Reise sowohl die Ortsveränderung selbst als auch den Aufenthalt am Zielort.

Die verwendeten Verkehrsmittel bilden hierbei eine sogenannte Reisekette (wie beispielsweise Bus – Flugzeug – Straßenbahn – Taxi).

WEBSITE SPEED

meiers-weltreisen.de website speed is normal. Page speed is important for visitors and search engines.

Get insights to improve your page loading time.

Page Loading Time

0.9s

This domain loads at the median speed of 0.9 seconds.

Speed Percentile

86%

meiers-weltreisen.de is faster than approximately 86 percent of the web. Your website page speed needs to be as fast as you can make it, without compromising the customer experience.

A good goal to achieve is a loading time of 2 seconds on desktop and mobile devices.

TRAFFIC

This website is ranked #305.453 by Alexa.

This rank is traffic based. The lower the rank is, the better the domain is ranked.

Alexa data for meiers-weltreisen.de

LAYOUT

Doctype HTML5 Arrow Responsive website, mobile-friendly. Arrow

Mobile Rendering

This website seems to be optimized for Mobile Visitors.

Phone
How meiers-weltreisen.de looks like on a mobile device such as an iPhone.

Tablet
How meiers-weltreisen.de looks like on a tablet such as an iPad.

Main colors used

These are the main HTML color codes used by this website. Arrow
  • 22% #ffffff
  • 10% #509060
  • 9% #002060
  • 7% #206020
  • 6% #d0e0e0
  • 6% #105010
  • 5% #307040
  • 5% #408050
  • 5% #207030
  • 2% #d0e0d0
  • 2% #002050
  • 2% #f0f0f0

Text/code ratio

meiers-weltreisen.de's text/code ratio is 4.14%. It's a bit low. Consider raising it by adding more text content of value for your visitors, or keeping your code clean.
Text / Code Ratio 4.14%

A good text to HTML ratio is anywhere from 25 to 70%.

This percentage refers to the visible text ratio, as opposed to HTML elements, image tags and other non-visible information.

Main HTML tags

Headings Arrow up

Great, we found headings on this page.

  • <H1> 1
  • <H2> 7
  • <H3> 0
  • <H4> 4
  • <H5> 0
  • <H6> 0
<H1>
Top level heading
Meıers weltreısen - ıhr spezialist für alles ferne
<H2>
2nd level heading
Trendziele für ıhr reisejahr 2020
Unsere empfehlung für ıhren malediven-urlaub
Aktuelle themen & specials
Unser reiseziel des monats: die abc-ınseln in der karibik
Mit meıers weltreısen steht ıhnen die ganze welt offen
<H4>
4th level heading
Service & beratung
Zahlungsarten
Sicher buchen & qualität
über uns
Alt attributes Arrow up

We found 13 images on this website.
6 ALT attributes are missing on your image tags. The issue affects 4 actual different images that could be loaded more than once in your page.

Alternative text allows you to add a description to an image.

Google rely on alternative text attributes to determine relevance to a search query. Alternative text also makes an image more likely to appear in a Google image search.

It looks like you're missing alternative text for 6 images on meiers-weltreisen.de. Check your website to make sure it's specified for each image on the page.

SOCIAL

This is an overview of your homepage shares on social networks.

It's a good start.

You should focus on obtaining more social shares to improve your overall SEO strategy. Check out these tips to build a better social media presence.

  • Facebook iconFacebook
  • Total Engagement 15
  • Likes 1
  • Shares 13
  • Comments 1
  • Pinterest iconPinterest 0
  • Linkedin iconLinkedin 0
  • Stumbleupon iconStumbleupon 0

SERVER

Server map
  • Service Provider (ISP)
  • PROFITBRICKS
  • IP Address
  • 213.244.192.73
  • Country
  • Flag for GermanyGermany
  • Region
  • Land Berlin , Berlin
  • Latitude and Longitude
  • 52.5327 : 13.4286

TRAVEL COMPETITORS IN GERMANY

BROWSE SEO REPORTS

SHARE